PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.20G016500.1.p
Common NameGLYMA_20G016500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 328aa    MW: 36957.9 Da    PI: 5.7609
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.20G016500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK54.81.9e-17226274452
               RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          +++l+dls  F+l+i +AA +L+v+ +++K iCR+  +kRWP+Rk++sl
  Glyma.20G016500.1.p 226 RMTLSDLSGVFHLTISAAAVKLDVGDSTVKSICRRGKLKRWPQRKVQSL 274
                          689********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151914.083214295IPR003035RWP-RK domain
PfamPF020421.7E-16227274IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MFPIDNPLLR FLFPRPKQQG NNVPFLQGNN NNDFPIGEGV VPDVVDVEEE GPPRRTGKEP  60
IPEGQGDRFF IHGHDIFFFG EGGVGNNVEP PQQNQTQPPN NQDVRSLCSW PPPPEPFSCS  120
CCEVLRQINY TNGVRFDKLE IHGAVGVINH AICLVEDKTS NRPPRDTYQI IDFCNKNTEE  180
IRNFLNVYCK ERTEAGFIPI EDPSMSAFYD ALCTGMDWTE RQRVPRMTLS DLSGVFHLTI  240
SAAAVKLDVG DSTVKSICRR GKLKRWPQRK VQSLAKKVRV LERALNSPDP GVKRRTLDEI  300
RRLQQEIIEN CGGITPTGIP MLQFDEE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006606627.10.0PREDICTED: uncharacterized protein LOC102660093
RefseqXP_006606628.10.0PREDICTED: uncharacterized protein LOC102660219
TrEMBLA0A0R0EGQ40.0A0A0R0EGQ4_SOYBN; Uncharacterized protein
STRINGGLYMA20G01991.10.0(Glycine max)
STRINGGLYMA20G02005.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF74782846
Representative plantOGRP1033348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.14e-07RWP-RK domain-containing protein